EP0273716A2
Expired / Lapsed
EP
⏱️ 0.0 years remaining
Synthetic peptides which induce cellular immunity to the aids virus and aids viral proteins
Assignee: United States Department of Commerce
•
Filing: 1987-12-23
•
Granted: —
•
Expires: 2007-12-23
Abstract
Abstract This invention relates to the identification of short peptide segments of AIDS virus proteins which elicit T cellular immunity, and to a method of inducing cellular immunity to native proteins of the AIDS virus by immunization with short synthetic peptides. Five potential peptides have been identified by searching for regions which can fold as a maximally amphipathic helix. These may be useful to include in either a synthetic peptide- or recombinant fragment-based vaccine.
Inventors
- 👤 Jay A. Berzofsky
- 👤 Kemp B. Cease
- 👤 Charles Delisi
- 👤 Hanah Margalit
- 👤 James L. Cornette
- 👤 Cecilia Spencer Ouyang
Bibliographic Details
Application Number
—
Jurisdiction
EP
Data Source
google_patents
Last Synchronized
2026-10-29 03:51
CPC Classifications
C; C07; C07K; C07K14/00; C07K14/005; A; A61; A61K; A61K39/00; C12; C12N; C12N2740/00; C12N2740/00011; C12N2740/10011; C12N2740/16011; C12N2740/16111; C12N2740/16122
Claims Analysis
Total Claims: 19
Claim 1
Independent Claim
55 words
Synthetic peptides which may serve as components of a vaccine for acquired immunodeficiency syndrome (AIDS), characterized in that said peptides are selected by searching for peptide regions which can fold as a maximally amphipathic helix and in that the peptides are recognized by T cells immune to the acquired immunodeficiency syndrome (AIDS) virus envelope protein.
Claim 2
Dependent Claim
55 words
Synthetic peptides which may serve as components of a vaccine for acquired immunodeficiency syndrome (AIDS), characterized in that said peptides are selected by searching for peptide regions which can fold as a maximally amphipathic helix and in that the peptides are recognized by T cells immune to the acquired immunodeficiency syndrome (AIDS) virus envelope protein.
Claim 3
Dependent Claim
22 words
Synthetic peptides comprising T cell sites env T1 and env T2 which are residues 428-443 and 112-124, respectively, utilizing standard epitope nomenclature.
Claim 4
Dependent Claim
22 words
Synthetic peptides comprising T cell sites env T1 and env T2 which are residues 428-443 and 112-124, respectively, utilizing standard epitope nomenclature.
Claim 5
Dependent Claim
12 words
The preparation of synthetic peptides corresponding to the sites of Claim 2.
Claim 6
Dependent Claim
18 words
Synthetic peptides substantially corresponding to the sites of Claim 2, and any short peptides substantially overlapping said sites.
Claim 7
Dependent Claim
51 words
The prediction of T cell antigenic peptides recognized by T lymphocytes and able to stimulate cellular immunity for the sequences selected from the group consisting of env T1 (residues 428-443) and env T2 (residues 112-124) with respect to the acquired immunodeficiency syndrome (AIDS) human T cell leukemia virus type III (HTLV-III).
Claim 8
Dependent Claim
51 words
The prediction of T cell antigenic peptides recognized by T lymphocytes and able to stimulate cellular immunity for the sequences selected from the group consisting of env T1 (residues 428-443) and env T2 (residues 112-124) with respect to the acquired immunodeficiency syndrome (AIDS) human T cell leukemia virus type III (HTLV-III).
Claim 9
Dependent Claim
19 words
The prediction of T cell antigenic peptides according to Claim 5 wherein the sequence is env T1 (residues 428-443).
Claim 10
Dependent Claim
19 words
The prediction of T cell antigenic peptides according to Claim 5 wherein the sequence is env T2 (residues 112-124).
Claim 11
Dependent Claim
61 words
Peptides corresponding to sequences from HIV viral proteins and selected by the method of predicting T-cell antigenic sites by searching for segments which have periodicity of hydrophobicity properties wherein said properties exhibit the capability of said segment to form amphipathic helices, and wherein said peptide, when included in a vaccine, are capable of inducing T-cell immunity to acquired immune deficiency syndrome.
Claim 12
Dependent Claim
61 words
Peptides corresponding to sequences from HIV viral proteins and selected by the method of predicting T-cell antigenic sites by searching for segments which have periodicity of hydrophobicity properties wherein said properties exhibit the capability of said segment to form amphipathic helices, and wherein said peptide, when included in a vaccine, are capable of inducing T-cell immunity to acquired immune deficiency syndrome.
Claim 13
Dependent Claim
37 words
The peptides of Claim 8, wherein said sequences are amino acid sequences selected from the group consisting of: FNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCV; KTFNGTGPCTNVSTVQCTHG; IRIQRGPGRAFVTIGKIGNMRQAHC; RAKWNNTLKQIDSKLREQFGNNK; TLPCRIKQIINMWQEVGKAMYAP; NNLLRAIEAQQHLLQLTVWGIK; SNKSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQ; ELLELDKWASLWNWFNITNWLWY; IVTRIVELLGRRGWEALKYWWNLLQYWSQELK; DRVIEVVQGAYRAIRHIPRRIRQGLERILL; ASVLSGGELDRWEKIRLR; ETSEGCRQILGQLQPSLQT; EIKDTKEALDKIEEEQNK; SPRTLNAWVKVVEEK; DIRQGPKEPFRDYVDRFYKTLRAEQA; ARVLAEAMSQVTNTATI; HEDIISLWDQSLK; and KQIINMWQEVGKAMYA.
Claim 14
Dependent Claim
15 words
The peptides of Claim 9, wherein said T-cell response is the induction of T-cell immunity.
Claim 15
Dependent Claim
19 words
The peptides of Claim 9, wherein said T-cell response is the induction of T-cell help for an antibody response.
Claim 16
Dependent Claim
23 words
A synthetic peptide capable of eliciting a T-cell response, said peptide substantially corresponding to amino acid sequences 428-443 of the HIV envelope protein.
Claim 17
Dependent Claim
23 words
A synthetic peptide capable of eliciting a T-cell response, said peptide substantially corresponding to amino acid sequences 428-443 of the HIV envelope protein.
Claim 18
Dependent Claim
23 words
A synthetic peptide capable of eliciting a T-cell response, said peptide substantially corresponding to amino acid sequences 112-124 of the HIV envelope protein.
Claim 19
Dependent Claim
23 words
A synthetic peptide capable of eliciting a T-cell response, said peptide substantially corresponding to amino acid sequences 112-124 of the HIV envelope protein.
References Cited (Backward Citations)
No citation records indexed.
USPTO Annuity & Maintenance Windows
Maintenance schedule is calculated for granted US utility patents.