US5066592A
Expired / Lapsed
US
⏱️ 0.0 years remaining
Trigramin - a platelet aggregation inhibiting polypeptide
Assignee: Temple University
•
Filing: 1990-09-19
•
Granted: 1991-11-19
•
Expires: 2010-09-19
Abstract
Abstract Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.
Inventors
- 👤 Tur-Fu Huang
- 👤 Stefan Niewiarowski
- 👤 John C. Holt
- 👤 Hanna Lukasiewicz
Bibliographic Details
Application Number
—
Jurisdiction
US
Data Source
google_patents
Last Synchronized
2026-11-01 11:13
CPC Classifications
C; C07; C07K; C07K14/00; C07K14/435; C07K14/46; A; A61; A61K; A61K38/00; Y; Y10; Y10S; Y10S530/00; Y10S530/855; Y10S530/856
Claims Analysis
Total Claims: 7
Claim 1
Independent Claim
14 words
The polypeptide in substantially pure chemical form having the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH.
Claim 2
Dependent Claim
14 words
The polypeptide in substantially pure chemical form having the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH.
Claim 3
Dependent Claim
21 words
A preparation for inhibiting fibrinogen-induced aggregation of human platelets comprising the polypeptide EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH, said preparation being free of phospholipase A contamination.
Claim 4
Dependent Claim
21 words
A preparation for inhibiting fibrinogen-induced aggregation of human platelets comprising the polypeptide EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH, said preparation being free of phospholipase A contamination.
Claim 5
Dependent Claim
26 words
A method of inhibiting fibrinogen binding to human platelets or fibrinogen-induced aggregation of human platelets comprising incubating human platelets with the polypeptide according to claim 1.
Claim 6
Dependent Claim
25 words
A method of inhibiting fibrinogen binding to human platelets or fibrinogen-induced aggregation of human platelets comprising incubating human platelets with the preparation of claim 2.
Claim 7
Dependent Claim
35 words
A method of inhibiting aggregation of platelets in a human being comprising administering to that person a polypeptide according to claim 1 to inhibit the occurrence of platelet aggregation in the bloodstream of said person.
References Cited (Backward Citations)
US4683291A
Cited
US4683291B1
Cited
USPTO Annuity & Maintenance Windows
| Annuity Stage | Window Opens | Payment Deadline | Surcharge Period Until | Estimated Fee | Status |
|---|---|---|---|---|---|
| 3.5 Years (Year 4) | 1994-11-18 | 1995-05-20 | 1995-11-19 | $2000.00 | Window Closed / Lapsed |
| 7.5 Years (Year 8) | 1998-11-18 | 1999-05-20 | 1999-11-19 | $3760.00 | Window Closed / Lapsed |
| 11.5 Years (Year 12) | 2002-11-18 | 2003-05-20 | 2003-11-19 | $7700.00 | Window Closed / Lapsed |